PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010795
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family BES1
Protein Properties Length: 327aa    MW: 35988.6 Da    PI: 9.3708
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010795genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822193.48e-60121362130
       DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                  + +rkp+w+ErEnn+rRERrRRa aaki++GLRaqGny+lpk++DnneVlkALc+eAGwvve+DGttyrkg +p+   +++g   +++p ss++ s+ 
  Lus10010795  12 APRRKPSWRERENNRRRERRRRATAAKIFTGLRAQGNYNLPKHCDNNEVLKALCHEAGWVVEEDGTTYRKGHRPP-PLDIVG---KVTPYSSQNPSPM 105
                  669************************************************************************.666666...567777777789* PP

       DUF822 100 ssalaspvesysaspksssfpspssldsisl 130
                  ss ++sp++sy+ sp+sssfpsps+++++++
  Lus10010795 106 SSLFPSPIPSYQVSPSSSSFPSPSRVENNNN 136
                  *************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.5E-5714134IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MTSDGATSTA AAPRRKPSWR ERENNRRRER RRRATAAKIF TGLRAQGNYN LPKHCDNNEV  60
LKALCHEAGW VVEEDGTTYR KGHRPPPLDI VGKVTPYSSQ NPSPMSSLFP SPIPSYQVSP  120
SSSSFPSPSR VENNNNPPSX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXT PPMSSPNSRN  180
HKPILPNWDS IARQSMASLN NSYPLYAASA PSSPTHRQFH APATIPECDE SDTSSTVESG  240
QWISFQKFAP AAAMATAMPP ASPTYNLVKP VPQQGLLSHD TIMGESGRSM EFEFGNGRVK  300
AWEGERIHEV GLDDLELTLG NGKGRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11332RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510347.11e-130PREDICTED: protein BRASSINAZOLE-RESISTANT 1
SwissprotQ8S3071e-113BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLB9R7Q41e-130B9R7Q4_RICCO; BRASSINAZOLE-RESISTANT 1 protein, putative
STRINGPOPTR_0014s04110.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.25e-92BES1 family protein